PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G2109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 261aa    MW: 29956.8 Da    PI: 6.3782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G2109genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd++l+++v+ +G g+W+++++ +g++R +k+c++rw +yl
      Gh_A08G2109 14 RGLWKAEEDLILKNYVETHGEGNWAKVSKLLGLKRGGKSCRLRWKNYL 61
                     788*****************************99************97 PP

2Myb_DNA-binding53.65.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++l+++ +++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A08G2109  67 RGAMSKEEEDLIIRMHNLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.698961IPR017930Myb domain
SuperFamilySSF466891.25E-2812108IPR009057Homeodomain-like
SMARTSM007174.1E-151363IPR001005SANT/Myb domain
PfamPF002492.0E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-221568IPR009057Homeodomain-like
CDDcd001672.26E-111761No hitNo description
PROSITE profilePS5129426.19262116IPR017930Myb domain
SMARTSM007178.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2469115IPR009057Homeodomain-like
CDDcd001678.59E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEENKREKKT ESKRGLWKAE EDLILKNYVE THGEGNWAKV SKLLGLKRGG KSCRLRWKNY  60
LRPNIKRGAM SKEEEDLIIR MHNLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKKSSVLG  120
KRKGKAIDES NHQSIPNQQN NTNTNIEIEN QGGEEPIAPP PAELPMISSP KTTTDDEGSM  180
GLLKVDGLTD NTWMERAVRC FDYDYDNNYE IETPLMMMNK NLNYAHMVFD EEPFTPCLDS  240
FVLFEAFGTD SDLGKTQTFL P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-231111524127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477127.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D2S7310.0A0A0D2S731_G
STRINGPOPTR_0018s12780.11e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.12e-65myb domain protein 82